PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn036321
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family G2-like
Protein Properties Length: 708aa    MW: 79289.7 Da    PI: 6.9454
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn036321genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like85.55.3e-27522575154
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYR 54 
                 k+r++Wt+eLH+ F +av+qLGG+++AtPk +l++m+++gLt++hvkSHLQ  R
  Achn036321 522 KERMKWTQELHDLFEKAVNQLGGPDRATPKGVLKAMGIQGLTIYHVKSHLQVQR 575
                 68*************************************************887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM002716.6E-31362IPR001623DnaJ domain
SuperFamilySSF465651.96E-32395IPR001623DnaJ domain
Gene3DG3DSA:1.10.287.1102.2E-34382IPR001623DnaJ domain
PROSITE profilePS5007624.556470IPR001623DnaJ domain
PfamPF002261.4E-26467IPR001623DnaJ domain
CDDcd062571.55E-24459IPR001623DnaJ domain
PRINTSPR006251.2E-27624IPR001623DnaJ domain
PRINTSPR006251.2E-272439IPR001623DnaJ domain
PRINTSPR006251.2E-274262IPR001623DnaJ domain
PROSITE patternPS0063604766IPR018253DnaJ domain, conserved site
PRINTSPR006251.2E-276281IPR001623DnaJ domain
SuperFamilySSF494934.1E-17159255IPR008971HSP40/DnaJ peptide-binding
Gene3DG3DSA:2.60.260.201.4E-33164242No hitNo description
CDDcd107473.75E-32165268No hitNo description
PfamPF015562.7E-27165274IPR002939Chaperone DnaJ, C-terminal
Gene3DG3DSA:2.60.260.201.0E-4243269No hitNo description
PfamPF121652.3E-42312424IPR021998Alfin
SuperFamilySSF579032.88E-10463502IPR011011Zinc finger, FYVE/PHD-type
Gene3DG3DSA:3.30.40.101.4E-9468505IPR013083Zinc finger, RING/FYVE/PHD-type
PROSITE profilePS5129412.102519579IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.8E-24520577IPR009057Homeodomain-like
SuperFamilySSF466892.51E-13521575IPR009057Homeodomain-like
TIGRFAMsTIGR015571.0E-20522576IPR006447Myb domain, plants
PfamPF002491.9E-8524573IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006457Biological Processprotein folding
GO:0003677Molecular FunctionDNA binding
GO:0042393Molecular Functionhistone binding
GO:0051082Molecular Functionunfolded protein binding
Sequence ? help Back to Top
Protein Sequence    Length: 708 aa     Download sequence    Send to blast
MGVDYYKILQ VDRNAKDDDL KKAYRKLAMK WHPDKNPNNK KEAEAKFKQI SEAYDVLSDS  60
QKRAVYDQYG EEGLMGQMPP PGSGGFPGAG AYEGGGPTSF RFNPRSADDI FSEFFGFPSP  120
FGDMGGSRAS ASGFPRGMFG EDIFSSLRGG GGEGSGSIPR KGAAIERTLP CSLEDLYKGT  180
TKKMKISRDV IDASGRPTTV EEILTIEIKP GWKKGTKITF PEKGNEQRGV IPSDLVFIID  240
EKPHSAFKRD GNDLIFTQKI SLVEALTGPE QIKLLKLLVS WLKAHSKLAY KMNKQKLNPM  300
DWLSGLLSGI GNKENLCLYG HPNERWEVTL PAEEVPPELP EPALGINFAR DGMNRRDWIS  360
LVAVHSDCWL LSVAFYLGAQ LNRNERKYFS YHGFSSEELT LPLMDRKRLF SLINDLPTVF  420
EVVTERKPVK DKPSADSGSK SRGSTKRSSD GQVKSTPKLA DENYEEDENE HSETLCGSCG  480
GNYNADEFWI GCDICEKWFH GKRVAQTLDS EMGSSRSDGS GKERMKWTQE LHDLFEKAVN  540
QLGGPDRATP KGVLKAMGIQ GLTIYHVKSH LQVQRSLRLK MEAQGRFLER IVEDFKNRVT  600
ITKPTKVFSP ISLPSLCEDS ESNAKEFESD SEIDKTEVRS DEEFRAPKRV RVDENVLLPR  660
YKVASIDFES YNQIMLARVV HPSYETSFPW SVAACQSPFM PSLYNYN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3agz_A1e-261602689118DnaJ homolog subfamily B member 1
3agz_B1e-261602689118DnaJ homolog subfamily B member 1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA18456
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.12e-22G2-like family protein